Identification
HMDB Protein ID CDBP05465
Secondary Accession Numbers Not Available
Name DNA-directed RNA polymerases I, II, and III subunit RPABC3
Description Not Available
Synonyms
  1. RNA polymerases I, II, and III subunit ABC3
  2. DNA-directed RNA polymerase II subunit H
  3. DNA-directed RNA polymerases I, II, and III 17.1 kDa polypeptide
  4. RPB17
  5. RPB8 homolog
  6. hRPB8
Gene Name POLR2H
Protein Type Enzyme
Biological Properties
General Function Not Available
Specific Function DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and small RNAs, such as 5S rRNA and tRNAs, respectively.
GO Classification
Biological Process
transcription elongation from RNA polymerase I promoter
transcription initiation from RNA polymerase I promoter
viral reproduction
protein phosphorylation
positive regulation of viral transcription
transcription elongation from RNA polymerase II promoter
transcription initiation from RNA polymerase II promoter
termination of RNA polymerase III transcription
transcription elongation from RNA polymerase III promoter
transcription-coupled nucleotide-excision repair
7-methylguanosine mRNA capping
mRNA splicing, via spliceosome
termination of RNA polymerase I transcription
Cellular Component
DNA-directed RNA polymerase II, core complex
cytoplasm
nucleolus
Molecular Function
zinc ion binding
DNA-directed RNA polymerase activity
Cellular Location Not Available
Pathways
Gene Properties
Chromosome Location 3
Locus 3q28
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 17143.115
Theoretical pI 4.678
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>gi|14589953|ref|NP_006223.2| DNA-directed RNA polymerases I, II, and III subunit RPABC3 [Homo sapiens]
MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVI
ASTLYEDGTL
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P52434
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:9195
References
General References Not Available