Identification
HMDB Protein ID CDBP05463
Secondary Accession Numbers Not Available
Name DNA-directed RNA polymerases I, II, and III subunit RPABC1
Description Not Available
Synonyms
  1. RNA polymerases I, II, and III subunit ABC1
  2. DNA-directed RNA polymerase II 23 kDa polypeptide
  3. DNA-directed RNA polymerase II subunit E
  4. RPB5 homolog
  5. XAP4
Gene Name POLR2E
Protein Type Enzyme
Biological Properties
General Function Not Available
Specific Function DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and small RNAs, such as 5S rRNA and tRNAs, respectively. Pol II is the central component of the basal RNA polymerase II transcription machinery. Pols are composed of mobile elements that move relative to each other. In Pol II, POLR2E/RPB5 is part of the lower jaw surrounding the central large cleft and thought to grab the incoming DNA template. Seems to be the major component in this process (By similarity).
GO Classification
Biological Process
termination of RNA polymerase III transcription
transcription elongation from RNA polymerase III promoter
transcription-coupled nucleotide-excision repair
7-methylguanosine mRNA capping
mRNA splicing, via spliceosome
virus-host interaction
viral reproduction
protein phosphorylation
positive regulation of viral transcription
transcription elongation from RNA polymerase II promoter
transcription initiation from RNA polymerase II promoter
Cellular Component
DNA-directed RNA polymerase II, core complex
Molecular Function
DNA binding
DNA-directed RNA polymerase activity
Cellular Location Not Available
Pathways
Gene Properties
Chromosome Location 19
Locus 19p13.3
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 24611.175
Theoretical pI 5.953
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>gi|14589951|ref|NP_002686.2| DNA-directed RNA polymerases I, II, and III subunit RPABC1 [Homo sapiens]
MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQFGDKPSEGRPRRTDLTV
LVAHNDDPTD
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P19388
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:9192
References
General References Not Available