| Identification |
|---|
| HMDB Protein ID
| CDBP05462 |
| Secondary Accession Numbers
| Not Available |
| Name
| DNA-directed RNA polymerase I subunit RPA43 |
| Description
| Not Available |
| Synonyms
|
- Twist neighbor protein
|
| Gene Name
| TWISTNB |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase I which synthesizes ribosomal RNA precursors. Through its association with RRN3/TIF-IA may be involved in recruitment of Pol I to rDNA promoters.
|
| GO Classification
|
| Biological Process |
| transcription, DNA-dependent |
| Cellular Component |
| microtubule cytoskeleton |
| nucleolus |
| Molecular Function |
| DNA-directed RNA polymerase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
| Name | SMPDB/Pathwhiz | KEGG | | RNA polymerase | Not Available |  |
|
| Gene Properties |
|---|
| Chromosome Location
| 7 |
| Locus
| 7p21.1 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 37432.025 |
| Theoretical pI
| 6.976 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|50962817|ref|NP_001002926.1| DNA-directed RNA polymerase I subunit RPA43 [Homo sapiens]
MAAGCSEAPRPAAASDGSLVGQAGVLPCLELPTYAAACALVNSRYSCLVAGPHQRHIALS
PRYLNRKRTG
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q3B726 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:18027 |
| References |
|---|
| General References
| Not Available |