| Identification |
|---|
| HMDB Protein ID
| CDBP05460 |
| Secondary Accession Numbers
| Not Available |
| Name
| ATP-dependent DNA helicase Q5 |
| Description
| Not Available |
| Synonyms
|
- DNA helicase, RecQ-like type 5
- RecQ protein-like 5
- RecQ5
|
| Gene Name
| RECQL5 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| May have an important role in DNA metabolism.
|
| GO Classification
|
| Biological Process |
| DNA repair |
| DNA recombination |
| Cellular Component |
| DNA-directed RNA polymerase II, holoenzyme |
| cytoplasm |
| nucleolus |
| nuclear membrane |
| Molecular Function |
| nucleic acid binding |
| ATP binding |
| ATP-dependent helicase activity |
| DNA helicase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 17 |
| Locus
| 17q25 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 48508.56 |
| Theoretical pI
| 9.022 |
| Pfam Domain Function
|
|
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|51242947|ref|NP_001003715.1| ATP-dependent DNA helicase Q5 isoform 2 [Homo sapiens]
MSSHHTTFPFDPERRVRSTLKKVFGFDSFKTPLQESATMAVVKGNKDVFVCMPTGAGKSL
CYQLPALLAK
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| O94762 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:9950 |
| References |
|---|
| General References
| Not Available |