| Identification |
|---|
| HMDB Protein ID
| CDBP05454 |
| Secondary Accession Numbers
| Not Available |
| Name
| Tyrosine-protein phosphatase non-receptor type 20 |
| Description
| Not Available |
| Synonyms
|
- hPTPN20
|
| Gene Name
| PTPN20A |
| Protein Type
| Receptor |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Tyrosine-protein phosphatase targeted to sites of actin polymerization in response of varied extracellular stimuli. Has tyrosine phosphatase activity towards various tyrosyl phosphorylated substrates.
|
| GO Classification
|
| Biological Process |
| peptidyl-tyrosine dephosphorylation |
| Cellular Component |
| cytoplasm |
| nucleus |
| microtubule organizing center |
| microtubule |
| Molecular Function |
| protein tyrosine phosphatase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 10 |
| Locus
| 10q11.22 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 48422.455 |
| Theoretical pI
| 5.768 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|108802604|ref|NP_001035816.1| protein tyrosine phosphatase, non-receptor type 20 isoform 1 [Homo sapiens]
MSSPRDFRAEPVNDYEGNDSEAEDLNFRETLPSSSQENTPRSKVFENKVNSEKVKLSLRN
FPHNDYEDVF
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q4JDL3 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:23423 |
| References |
|---|
| General References
| Not Available |