| Identification |
|---|
| HMDB Protein ID
| CDBP05449 |
| Secondary Accession Numbers
| Not Available |
| Name
| Probable histone-lysine N-methyltransferase PRDM7 |
| Description
| Not Available |
| Synonyms
|
- PR domain zinc finger protein 7
- PR domain-containing protein 7
|
| Gene Name
| PRDM7 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Probable histone methyltransferase (By similarity).
|
| GO Classification
|
| Biological Process |
| histone lysine methylation |
| regulation of transcription, DNA-dependent |
| Cellular Component |
| chromosome |
| nucleus |
| Molecular Function |
| nucleic acid binding |
| histone-lysine N-methyltransferase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 16 |
| Locus
| 16q24.3 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 55777.045 |
| Theoretical pI
| 7.879 |
| Pfam Domain Function
|
|
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|148271100|ref|NP_001091643.1| probable histone-lysine N-methyltransferase PRDM7 isoform 1 [Homo sapiens]
MSPERSQEESPEGDTERTERKPMVKDAFKDISIYFTKEEWAEMGDWEKTRYRNVKMNYNA
LITVGLRATR
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9NQW5 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:9351 |
| References |
|---|
| General References
| Not Available |