| Identification |
|---|
| HMDB Protein ID
| CDBP05447 |
| Secondary Accession Numbers
| Not Available |
| Name
| Protein phosphatase methylesterase 1 |
| Description
| Not Available |
| Synonyms
|
- PME-1
|
| Gene Name
| PPME1 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Demethylates proteins that have been reversibly carboxymethylated. Demethylates PPP2CB (in vitro) and PPP2CA. Binding to PPP2CA displaces the manganese ion and inactivates the enzyme.
|
| GO Classification
|
| Biological Process |
| protein demethylation |
| Molecular Function |
| protein phosphatase type 2A regulator activity |
| carboxylesterase activity |
| protein C-terminal methylesterase activity |
| protein phosphatase 2A binding |
| protein phosphatase inhibitor activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 11 |
| Locus
| 11q13.4 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 43869.905 |
| Theoretical pI
| 5.845 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|409971401|ref|NP_001258522.1| protein phosphatase methylesterase 1 isoform b [Homo sapiens]
MSALEKSMHLGRLPSRPPLPGSGGSQSGAKMRMGPGRKRDFSPVPWSQYFESMEDVEVEN
ETGKDTFRVY
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9Y570 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:30178 |
| References |
|---|
| General References
| Not Available |