| Identification |
|---|
| HMDB Protein ID
| CDBP05434 |
| Secondary Accession Numbers
| Not Available |
| Name
| Pirin |
| Description
| Not Available |
| Synonyms
|
- Probable quercetin 2,3-dioxygenase PIR
- Probable quercetinase
|
| Gene Name
| PIR |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Possible transcriptional coregulator. May contribute to the regulation of cellular processes via its interaction with BCL3. May be required for efficient terminal myeloid maturation of hematopoietic cells. May play a role in the regulation of cell migration. May promote apoptosis when overexpressed. Has quercetin 2,3-dioxygenase activity (in vitro).
|
| GO Classification
|
| Biological Process |
| transcription from RNA polymerase II promoter |
| monocyte differentiation |
| Cellular Component |
| cytoplasm |
| nucleus |
| Molecular Function |
| metal ion binding |
| quercetin 2,3-dioxygenase activity |
| transcription cofactor activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
| Name | SMPDB/Pathwhiz | KEGG | | quercetin degradation | Not Available | Not Available |
|
| Gene Properties |
|---|
| Chromosome Location
| X |
| Locus
| Xp22.2 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 32113.195 |
| Theoretical pI
| 6.922 |
| Pfam Domain Function
|
|
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|66363697|ref|NP_001018119.1| pirin [Homo sapiens]
MGSSKKVTLSVLSREQSEGVGARVRRSIGRPELKNLDPFLLFDEFKGGRPGGFPDHPHRG
FETVSYLLEG
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| O00625 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:30048 |
| References |
|---|
| General References
| Not Available |