Identification
HMDB Protein ID CDBP05433
Secondary Accession Numbers Not Available
Name ATP-dependent DNA helicase PIF1
Description Not Available
Synonyms
  1. PIF1/RRM3 DNA helicase-like protein
Gene Name PIF1
Protein Type Enzyme
Biological Properties
General Function Not Available
Specific Function DNA-dependent ATPase and DNA helicase inhibiting telomerase activity by unwinding DNA/RNA duplex formed by telomerase RNA and telomeric DNA in a 5' to 3' polarity. Negatively regulates telomere length and such inhibition requires its ATPase activity. Tightly cell cycle regulated and expressed in late S/G2 phase.
GO Classification
Biological Process
negative regulation of telomerase activity
regulation of telomere maintenance
Cellular Component
nuclear chromosome, telomeric region
Molecular Function
single-stranded DNA-dependent ATP-dependent DNA helicase activity
magnesium ion binding
ATP-dependent 5'-3' DNA/RNA helicase activity
telomeric DNA binding
ATP binding
ATP-dependent 5'-3' DNA helicase activity
Cellular Location Not Available
Pathways
Gene Properties
Chromosome Location 15
Locus 15q22.31
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 69797.78
Theoretical pI 9.718
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>gi|82546872|ref|NP_079325.2| ATP-dependent DNA helicase PIF1 [Homo sapiens]
MLSGIEAAAGEYEDSELRCRVAVEELSPGGQPRRRQALRTAELSLGRNERRELMLRLQAP
GPAGRPRCFP
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9H611
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:26220
References
General References Not Available