| Identification |
|---|
| HMDB Protein ID
| CDBP05432 |
| Secondary Accession Numbers
| Not Available |
| Name
| Histone lysine demethylase PHF8 |
| Description
| Not Available |
| Synonyms
|
- PHD finger protein 8
|
| Gene Name
| PHF8 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Histone lysine demethylase with selectivity for the di- and monomethyl states that plays a key role cell cycle progression, rDNA transcription and brain development. Demethylates mono- and dimethylated histone H3 'Lys-9' residue (H3K9Me1 and H3K9Me2), dimethylated H3 'Lys-27' (H3K27Me2) and monomethylated histone H4 'Lys-20' residue (H4K20Me1). Acts as a transcription activator as H3K9Me1, H3K9Me2, H3K27Me2 and H4K20Me1 are epigenetic repressive marks. Involved in cell cycle progression by being required to control G1-S transition. Acts as a coactivator of rDNA transcription, by activating polymerase I (pol I) mediated transcription of rRNA genes. Required for brain development, probably by regulating expression of neuron-specific genes. Only has activity toward H4K20Me1 when nucleosome is used as a substrate and when not histone octamer is used as substrate. May also have weak activity toward dimethylated H3 'Lys-36' (H3K36Me2), however, the relevance of this result remains unsure in vivo. Specifically binds trimethylated 'Lys-4' of histone H3 (H3K4me3), affecting histone demethylase specificity: has weak activity toward H3K9Me2 in absence of H3K4me3, while it has high activity toward H3K9me2 when binding H3K4me3.
|
| GO Classification
|
| Biological Process |
| negative regulation of chromatin silencing at rDNA |
| G1/S transition of mitotic cell cycle |
| brain development |
| transcription, DNA-dependent |
| positive regulation of transcription from RNA polymerase I promoter |
| Cellular Component |
| nucleolus |
| Molecular Function |
| histone demethylase activity (H3-K9 specific) |
| histone demethylase activity (H4-K20 specific) |
| oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen |
| iron ion binding |
| methylated histone residue binding |
| zinc ion binding |
| chromatin binding |
| histone demethylase activity (H3-K36 specific) |
| histone demethylase activity (H3-K27 specific) |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| X |
| Locus
| Xp11.22 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 117862.955 |
| Theoretical pI
| 8.718 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|296531349|ref|NP_001171825.1| histone lysine demethylase PHF8 isoform 1 [Homo sapiens]
MNRSRAIVQRGRVLPPPAPLDTTNLAGRRTLQGRAKMASVPVYCLCRLPYDVTRFMIECD
MCQDWFHGSC
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9UPP1 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:20672 |
| References |
|---|
| General References
| Not Available |