| Identification |
| HMDB Protein ID
| CDBP05423 |
| Secondary Accession Numbers
| Not Available |
| Name
| Poly(A) RNA polymerase, mitochondrial |
| Description
| Not Available |
| Synonyms
|
- PAP
- PAP-associated domain-containing protein 1
- Polynucleotide adenylyltransferase
- Terminal uridylyltransferase 1
- mtPAP
- TUTase 1
|
| Gene Name
| MTPAP |
| Protein Type
| Enzyme |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Polymerase that creates the 3' poly(A) tail of mitochondrial transcripts. Can use all four nucleotides, but has higher activity with ATP and UTP (in vitro). Plays a role in replication-dependent histone mRNA degradation. May be involved in the terminal uridylation of mature histone mRNAs before their degradation is initiated. Might be responsible for the creation of some UAA stop codons which are not encoded in mtDNA.
|
| GO Classification
|
| Biological Process |
| histone mRNA catabolic process |
| mRNA polyadenylation |
| transcription, DNA-dependent |
| cell death |
| Cellular Component |
| plasma membrane |
| Golgi apparatus |
| nucleus |
| mitochondrion |
| Molecular Function |
| manganese ion binding |
| magnesium ion binding |
| ATP binding |
| RNA binding |
| UTP binding |
| polynucleotide adenylyltransferase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 10 |
| Locus
| 10p11.23 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 66170.995 |
| Theoretical pI
| 9.044 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|190194365|ref|NP_060579.3| poly(A) RNA polymerase, mitochondrial precursor [Homo sapiens]
MAVPGVGLLTRLNLCARRRTRVQRPIVRLLSCPGTVAKDLRRDEQPSGSVETGFEDKIPK
RRFSEMQNER
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9NVV4 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:25532 |
| References |
| General References
| Not Available |