| Identification |
|---|
| HMDB Protein ID
| CDBP05422 |
| Secondary Accession Numbers
| Not Available |
| Name
| Dynamin-like 120 kDa protein, mitochondrial |
| Description
| Not Available |
| Synonyms
|
- Optic atrophy protein 1
|
| Gene Name
| OPA1 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Dynamin-related GTPase required for mitochondrial fusion and regulation of apoptosis. May form a diffusion barrier for proteins stored in mitochondrial cristae. Proteolytic processing in response to intrinsic apoptotic signals may lead to disassembly of OPA1 oligomers and release of the caspase activator cytochrome C (CYCS) into the mitochondrial intermembrane space.
Dynamin-like 120 kDa protein, form S1: Inactive form produced by cleavage at S1 position by OMA1 following stress conditions that induce loss of mitochondrial membrane potential, leading to negative regulation of mitochondrial fusion.
|
| GO Classification
|
| Biological Process |
| cellular senescence |
| inner mitochondrial membrane organization |
| negative regulation of intrinsic apoptotic signaling pathway |
| visual perception |
| mitochondrial fusion |
| neural tube closure |
| negative regulation of release of cytochrome c from mitochondria |
| mitochondrial fission |
| apoptotic process |
| axon transport of mitochondrion |
| Cellular Component |
| mitochondrial crista |
| dendrite |
| mitochondrial outer membrane |
| integral to membrane |
| mitochondrial intermembrane space |
| Molecular Function |
| magnesium ion binding |
| GTPase activity |
| GTP binding |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 3 |
| Locus
| 3q28-q29 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 111629.755 |
| Theoretical pI
| 7.873 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|224831243|ref|NP_056375.2| dynamin-like 120 kDa protein, mitochondrial isoform 1 [Homo sapiens]
MWRLRRAAVACEVCQSLVKHSSGIKGSLPLQKLHLVSRSIYHSHHPTLKLQRPQLRTSFQ
QFSSLTNLPL
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| O60313 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:8140 |
| References |
|---|
| General References
| Not Available |