| Identification |
|---|
| HMDB Protein ID
| CDBP05421 |
| Secondary Accession Numbers
| Not Available |
| Name
| Alpha N-terminal protein methyltransferase 1B |
| Description
| Not Available |
| Synonyms
|
- Methyltransferase-like protein 11B
- X-Pro-Lys N-terminal protein methyltransferase 1B
- NTM1B
|
| Gene Name
| METTL11B |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Alpha-N-methyltransferase that methylates the N-terminus of target proteins containing the N-terminal motif [Ala/Pro/Ser]-Pro-Lys when the initiator Met is cleaved. Specifically catalyzes mono-, di- or tri-methylation of exposed alpha-amino group of Ala or Ser residue in the [Ala/Ser]-Pro-Lys motif and mono- or di-methylation of Pro in the Pro-Pro-Lys motif (By similarity).
|
| GO Classification
|
| Molecular Function |
| methyltransferase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 1 |
| Locus
| 1q24.2 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 32400.0 |
| Theoretical pI
| 6.983 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|209870065|ref|NP_001129579.1| alpha N-terminal protein methyltransferase 1B [Homo sapiens]
MAHRGAHFAFRSRWQKTDDELCRHSMSFILHKAIRNDFFQSYLYLLEKIPLVKLYALTSQ
VINGEMQFYA
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q5VVY1 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:31932 |
| References |
|---|
| General References
| Not Available |