Showing Protein N-terminal Xaa-Pro-Lys N-methyltransferase 1 (CDBP05420)

IdentificationBiological propertiesGene propertiesProtein propertiesExternal linksReferencesXMLShow 2 compounds
Identification
HMDB Protein ID CDBP05420
Secondary Accession Numbers Not Available
Name N-terminal Xaa-Pro-Lys N-methyltransferase 1
Description Not Available
Synonyms
  1. Alpha N-terminal protein methyltransferase 1A
  2. Methyltransferase-like protein 11A
  3. N-terminal RCC1 methyltransferase
  4. X-Pro-Lys N-terminal protein methyltransferase 1A
  5. NTM1A
Gene Name NTMT1
Protein Type Enzyme
Biological Properties
General Function Not Available
Specific Function Alpha-N-methyltransferase that methylates the N-terminus of target proteins containing the N-terminal motif [Ala/Pro/Ser]-Pro-Lys when the initiator Met is cleaved. Specifically catalyzes mono-, di- or tri-methylation of exposed alpha-amino group of Ala or Ser residue in the [Ala/Ser]-Pro-Lys motif and mono- or di-methylation of Pro in the Pro-Pro-Lys motif. Responsible for the N-terminal methylation of KLHL31, MYL2, MYL3, RB1, RCC1, RPL23A and SET. Required during mitosis for normal bipolar spindle formation and chromosome segregation via its action on RCC1.
GO Classification
Biological Process
spindle organization
N-terminal peptidyl-alanine trimethylation
N-terminal peptidyl-proline dimethylation
N-terminal peptidyl-serine dimethylation
N-terminal peptidyl-serine trimethylation
chromosome segregation
Cellular Component
cytoplasm
nucleus
Molecular Function
protein methyltransferase activity
Cellular Location Not Available
Pathways
Gene Properties
Chromosome Location 9
Locus 9q34.11
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 25386.78
Theoretical pI 5.51
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence 
>gi|56676399|ref|NP_054783.2| N-terminal Xaa-Pro-Lys N-methyltransferase 1 [Homo sapiens]
MTSEVIEDEKQFYSKAKTYWKQIPPTVDGMLGGYGHISSIDINSSRKFLQRFLREGPNKT
GTSCALDCGA
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9BV86
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:23373
References
General References Not Available