Identification
HMDB Protein ID CDBP05419
Secondary Accession Numbers Not Available
Name Sodium-dependent phosphate transport protein 2A
Description Not Available
Synonyms
  1. Sodium-phosphate transport protein 2A
  2. Na(+)-dependent phosphate cotransporter 2A
  3. NaPi-3
  4. Sodium/phosphate cotransporter 2A
  5. Solute carrier family 34 member 1
  6. Na(+)/Pi cotransporter 2A
  7. NaPi-2a
Gene Name SLC34A1
Protein Type Transporter
Biological Properties
General Function Not Available
Specific Function May be involved in actively transporting phosphate into cells via Na(+) cotransport in the renal brush border membrane. Probably mediates 70-80% of the apical influx.
GO Classification
Biological Process
response to cadmium ion
bone remodeling
response to magnesium ion
sodium ion transport
response to lead ion
phosphate ion homeostasis
response to mercury ion
Cellular Component
basolateral plasma membrane
brush border membrane
integral to plasma membrane
Molecular Function
symporter activity
sodium-dependent phosphate transmembrane transporter activity
Cellular Location Not Available
Pathways
Gene Properties
Chromosome Location 5
Locus 5q35
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 36602.125
Theoretical pI 6.651
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>gi|262399385|ref|NP_001161051.1| sodium-dependent phosphate transport protein 2A isoform 2 [Homo sapiens]
MLSYGERLGSPAVSPLPVRGGHVMRGTAFAYVPSPQVLHRIPGTSAYAFPSLGPVALAEH
TCPCGEVLER
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q06495
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:11019
References
General References Not Available