| Identification |
|---|
| HMDB Protein ID
| CDBP05417 |
| Secondary Accession Numbers
| Not Available |
| Name
| Nitrogen permease regulator 2-like protein |
| Description
| Not Available |
| Synonyms
|
- NPR2-like protein
- Gene 21 protein
- Tumor suppressor candidate 4
- G21 protein
|
| Gene Name
| NPRL2 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Suppresses Src-dependent tyrosine phosphorylation and activation of PDPK1 and its downstream signaling. Down-regulates PDPK1 kinase activity by interfering with tyrosine phosphorylation at the Tyr-9 Tyr-373 and Tyr-376 residues. May act as a tumor suppressor. Suppresses cell growth and enhanced sensitivity to various anticancer drugs.
|
| GO Classification
|
| Biological Process |
| negative regulation of kinase activity |
| Cellular Component |
| cytoplasm |
| Molecular Function |
| protein kinase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 3 |
| Locus
| 3p21.3 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 43658.085 |
| Theoretical pI
| 6.528 |
| Pfam Domain Function
|
|
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|50592992|ref|NP_006536.3| nitrogen permease regulator 2-like protein [Homo sapiens]
MGSGCRIECIFFSEFHPTLGPKITYQVPEDFISRELFDTVQVYIITKPELQNKLITVTAM
EKKLIGCPVC
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q8WTW4 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:24969 |
| References |
|---|
| General References
| Not Available |