Identification |
HMDB Protein ID
| CDBP05416 |
Secondary Accession Numbers
| Not Available |
Name
| Bifunctional lysine-specific demethylase and histidyl-hydroxylase NO66 |
Description
| Not Available |
Synonyms
|
- 60S ribosomal protein L8 histidine hydroxylase
- Histone lysine demethylase NO66
- Myc-associated protein with JmjC domain
- Nucleolar protein 66
- Ribosomal oxygenase NO66
- hsNO66
- ROX
|
Gene Name
| NO66 |
Protein Type
| Enzyme |
Biological Properties |
General Function
| Not Available |
Specific Function
| Oxygenase that can act as both a histone lysine demethylase and a ribosomal histidine hydroxylase. Specifically demethylates 'Lys-4' (H3K4me) and 'Lys-36' (H3K36me) of histone H3, thereby playing a central role in histone code. Preferentially demethylates trimethylated H3 'Lys-4' (H3K4me3) and monomethylated H3 'Lys-4' (H3K4me1) residues, while it has weaker activity for dimethylated H3 'Lys-36' (H3K36me2). Also catalyzes the hydroxylation of 60S ribosomal protein L8 on 'His-216'. Acts as a regulator of osteoblast differentiation via its interaction with SP7/OSX by demethylating H3K4me and H3K36me, thereby inhibiting SP7/OSX-mediated promoter activation (By similarity). May also play a role in ribosome biogenesis and in the replication or remodeling of certain heterochromatic region. Participates in MYC-induced transcriptional activation.
|
GO Classification
|
Biological Process |
negative regulation of transcription, DNA-dependent |
negative regulation of osteoblast differentiation |
transcription, DNA-dependent |
Cellular Component |
nucleolus |
nucleus |
nucleoplasm |
Molecular Function |
oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen |
iron ion binding |
histone demethylase activity (H3-K4 specific) |
histone demethylase activity (H3-K36 specific) |
|
Cellular Location
|
Not Available
|
Pathways
|
Not Available
|
Gene Properties |
Chromosome Location
| 14 |
Locus
| 14q24.3 |
SNPs
| Not Available |
Gene Sequence
|
Not Available
|
Protein Properties |
Number of Residues
| Not Available |
Molecular Weight
| 71084.97 |
Theoretical pI
| 6.455 |
Pfam Domain Function
|
Not Available |
Signals
|
Not Available
|
Transmembrane Regions
|
Not Available
|
Protein Sequence
|
>gi|106879206|ref|NP_078920.2| bifunctional lysine-specific demethylase and histidyl-hydroxylase NO66 [Homo sapiens]
MDGLQASAGPLRRGRPKRRRKPQPHSGSVLALPLRSRKIRKQLRSVVSRMAALRTQTLPS
ENSEESRVES
|
External Links |
GenBank ID Protein
| Not Available |
UniProtKB/Swiss-Prot ID
| Q9H6W3 |
UniProtKB/Swiss-Prot Entry Name
| Not Available |
PDB IDs
|
|
GenBank Gene ID
| Not Available |
GeneCard ID
| Not Available |
GenAtlas ID
| Not Available |
HGNC ID
| HGNC:20968 |
References |
General References
| Not Available |