| Identification |
| HMDB Protein ID
| CDBP05414 |
| Secondary Accession Numbers
| Not Available |
| Name
| Omega-amidase NIT2 |
| Description
| Not Available |
| Synonyms
|
- Nitrilase homolog 2
|
| Gene Name
| NIT2 |
| Protein Type
| Enzyme |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Has a omega-amidase activity. The role of omega-amidase is to remove potentially toxic intermediates by converting alpha-ketoglutaramate and alpha-ketosuccinamate to biologically useful alpha-ketoglutarate and oxaloacetate, respectively. Overexpression decreases the colony-forming capacity of cultured cells by arresting cells in the G2 phase of the cell cycle.
|
| GO Classification
|
| Biological Process |
| nitrogen compound metabolic process |
| Cellular Component |
| centrosome |
| cytoplasm |
| mitochondrion |
| Molecular Function |
| omega-amidase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
| Name | SMPDB/Pathwhiz | KEGG | | Alanine, aspartate and glutamate metabolism | Not Available |  |
|
| Gene Properties |
| Chromosome Location
| 3 |
| Locus
| 3q12.2 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 30607.645 |
| Theoretical pI
| 7.212 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|9910460|ref|NP_064587.1| omega-amidase NIT2 [Homo sapiens]
MTSFRLALIQLQISSIKSDNVTRACSFIREAATQGAKIVSLPECFNSPYGAKYFPEYAEK
IPGESTQKLS
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9NQR4 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:29878 |
| References |
| General References
| Not Available |