| Identification |
|---|
| HMDB Protein ID
| CDBP05412 |
| Secondary Accession Numbers
| Not Available |
| Name
| Magnesium transporter NIPA3 |
| Description
| Not Available |
| Synonyms
|
- NIPA-like protein 1
- Non-imprinted in Prader-Willi/Angelman syndrome region protein 3
|
| Gene Name
| NIPAL1 |
| Protein Type
| Transporter |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Acts as a Mg(2+) transporter. Can also transport other divalent cations such as Fe(2+), Sr(2+), Ba(2+), Mn(2+), Cu(2+) and Co(2+) but to a much less extent than Mg(2+) (By similarity).
|
| GO Classification
|
| Cellular Component |
| integral to membrane |
| Molecular Function |
| magnesium ion transmembrane transporter activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 4 |
| Locus
| 4p12 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 44637.595 |
| Theoretical pI
| 5.999 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|46409302|ref|NP_997213.1| magnesium transporter NIPA3 [Homo sapiens]
MGAQVRLPPGEPCREGYVLSLVCPNSSQAWCEITNVSQLLASPVLYTDLNYSINNLSISA
NVENKYSLYV
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q6NVV3 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:27194 |
| References |
|---|
| General References
| Not Available |