| Identification |
|---|
| HMDB Protein ID
| CDBP05411 |
| Secondary Accession Numbers
| Not Available |
| Name
| Magnesium transporter NIPA2 |
| Description
| Not Available |
| Synonyms
|
- Non-imprinted in Prader-Willi/Angelman syndrome region protein 2
|
| Gene Name
| NIPA2 |
| Protein Type
| Transporter |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Acts as a selective Mg(2+) transporter (By similarity).
|
| GO Classification
|
| Cellular Component |
| early endosome |
| integral to membrane |
| plasma membrane |
| Molecular Function |
| magnesium ion transmembrane transporter activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 15 |
| Locus
| 15q11.2 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 39184.635 |
| Theoretical pI
| 8.228 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|57013272|ref|NP_001008860.1| magnesium transporter NIPA2 isoform a [Homo sapiens]
MSQGRGKYDFYIGLGLAMSSSIFIGGSFILKKKGLLRLARKGSMRAGQGGHAYLKEWLWW
AGLLSMGAGE
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q8N8Q9 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:17044 |
| References |
|---|
| General References
| Not Available |