Identification
HMDB Protein ID CDBP05410
Secondary Accession Numbers Not Available
Name Magnesium transporter NIPA1
Description Not Available
Synonyms
  1. Non-imprinted in Prader-Willi/Angelman syndrome region protein 1
  2. Spastic paraplegia 6 protein
Gene Name NIPA1
Protein Type Transporter
Biological Properties
General Function Not Available
Specific Function Acts as a Mg(2+) transporter. Can also transport other divalent cations such as Fe(2+), Sr(2+), Ba(2+), Mn(2+) and Co(2+) but to a much less extent than Mg(2+) (By similarity).
GO Classification
Biological Process
cell death
Cellular Component
plasma membrane
early endosome
integral to membrane
Molecular Function
magnesium ion transmembrane transporter activity
Cellular Location Not Available
Pathways
Gene Properties
Chromosome Location 15
Locus 15q11.2
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 27309.285
Theoretical pI 7.168
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>gi|214010179|ref|NP_001135747.1| magnesium transporter NIPA1 isoform 2 [Homo sapiens]
MAVGQIGNFLAYTAVPTVLVTPLGALGVPFGSILASYLLKEKLNILGKLGCLLSCAGSVV
LIIHSPKSES
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q7RTP0
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:17043
References
General References Not Available