| Identification |
|---|
| HMDB Protein ID
| CDBP05409 |
| Secondary Accession Numbers
| Not Available |
| Name
| Ribosomal RNA small subunit methyltransferase NEP1 |
| Description
| Not Available |
| Synonyms
|
- 18S rRNA (pseudouridine-N1-)-methyltransferase NEP1
- 18S rRNA Psi1248 methyltransferase
- Nucleolar protein EMG1 homolog
- Protein C2f
- Ribosome biogenesis protein NEP1
|
| Gene Name
| EMG1 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Involved in 40S ribosomal subunit biogenesis and 18S rRNA processing. Specifically catalyzes the N1-methylation of pseudouridine at position 1248 (Psi1248) in 18S rRNA. Thus, appears to be the methyltransferase involved in the biosynthesis of the hypermodified N1-methyl-N3-(3-amino-3-carboxypropyl) pseudouridine (m1acp3-Psi) in position 1248 in 18S rRNA. Is not able to methylate uridine at this position.
|
| GO Classification
|
| Biological Process |
| ribosomal small subunit biogenesis |
| Cellular Component |
| cytoplasm |
| nucleolus |
| Molecular Function |
| RNA binding |
| rRNA (pseudouridine) methyltransferase activity |
| rRNA binding |
|
| Cellular Location
|
Not Available
|
| Pathways
|
| Name | SMPDB/Pathwhiz | KEGG | | Ribosome biogenesis in eukaryotes | Not Available |  |
|
| Gene Properties |
|---|
| Chromosome Location
| 12 |
| Locus
| 12p13.3 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 26719.905 |
| Theoretical pI
| 9.178 |
| Pfam Domain Function
|
|
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|194328699|ref|NP_006322.4| ribosomal RNA small subunit methyltransferase NEP1 [Homo sapiens]
MAAPSDGFKPRERSGGEQAQDWDALPPKRPRLGAGNKIGGRRLIVVLEGASLETVKVGKT
YELLNCDKHK
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q92979 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:16912 |
| References |
|---|
| General References
| Not Available |