| Identification |
|---|
| HMDB Protein ID
| CDBP05408 |
| Secondary Accession Numbers
| Not Available |
| Name
| Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 4 |
| Description
| Not Available |
| Synonyms
|
- Glucosaminyl N-deacetylase/N-sulfotransferase 4
- N-heparan sulfate sulfotransferase 4
- NDST-4
- N-HSST 4
|
| Gene Name
| NDST4 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Essential bifunctional enzyme that catalyzes both the N-deacetylation and the N-sulfation of glucosamine (GlcNAc) of the glycosaminoglycan in heparan sulfate. Modifies the GlcNAc-GlcA disaccharide repeating sugar backbone to make N-sulfated heparosan, a prerequisite substrate for later modifications in heparin biosynthesis. Has low deacetylase activity but high sulfotransferase activity (By similarity).
|
| GO Classification
|
| Biological Process |
| heparan sulfate proteoglycan biosynthetic process |
| heparin biosynthetic process |
| Cellular Component |
| integral to membrane |
| Golgi membrane |
| Molecular Function |
| deacetylase activity |
| [heparan sulfate]-glucosamine N-sulfotransferase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
| Name | SMPDB/Pathwhiz | KEGG | | heparan sulfate biosynthesis | Not Available | Not Available | | heparin biosynthesis | Not Available | Not Available | | Glycosaminoglycan biosynthesis - heparan sulfate / heparin | Not Available |  |
|
| Gene Properties |
|---|
| Chromosome Location
| 4 |
| Locus
| 4q26 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 100714.905 |
| Theoretical pI
| 7.55 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|12007650|ref|NP_072091.1| bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 4 [Homo sapiens]
MNLIVKLRRSFRTLIVLLATFCLVSIVISAYFLYSGYKQEMTLIETTAEAECTDIKILPY
RSMELKTVKP
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9H3R1 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:20779 |
| References |
|---|
| General References
| Not Available |