| Identification |
| HMDB Protein ID
| CDBP05401 |
| Secondary Accession Numbers
| Not Available |
| Name
| N-acetylaspartate synthetase |
| Description
| Not Available |
| Synonyms
|
- NAA synthetase
- Camello-like protein 3
- N-acetyltransferase 8-like protein
|
| Gene Name
| NAT8L |
| Protein Type
| Enzyme |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Plays a role in the regulation of lipogenesis by producing N-acetylaspartate acid (NAA), a brain-specific metabolite. NAA occurs in high concentration in brain and its hydrolysis plays a significant part in the maintenance of intact white matter. Promotes dopamine uptake by regulating TNF-alpha expression. Attenuates methamphetamine-induced inhibition of dopamine uptake.
|
| GO Classification
|
| Biological Process |
| positive regulation of dopamine uptake involved in synaptic transmission |
| Cellular Component |
| mitochondrial membrane |
| rough endoplasmic reticulum membrane |
| integral to membrane |
| Molecular Function |
| aspartate N-acetyltransferase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 4 |
| Locus
| 4p16.3 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 32836.875 |
| Theoretical pI
| 8.821 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|263192221|ref|NP_848652.2| N-acetylaspartate synthetase [Homo sapiens]
MHCGPPDMVCETKIVAAEDHEALPGAKKDALLAAAGAMWPPLPAAPGPAAAPPAPPPAPV
AQPHGGAGGA
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q8N9F0 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:26742 |
| References |
| General References
| Not Available |