Identification
HMDB Protein ID CDBP05399
Secondary Accession Numbers Not Available
Name N-alpha-acetyltransferase 60
Description Not Available
Synonyms
  1. Histone acetyltransferase type B protein 4
  2. N-acetyltransferase 15
  3. NatF catalytic subunit
  4. HAT4
Gene Name NAA60
Protein Type Enzyme
Biological Properties
General Function Not Available
Specific Function Histone acetyltransferase localized in the Golgi apparatus that mediates acetylation of free histone H4, thereby facilitating nucleosome assembly. Has a preference for free histone H4 'Lys-20'(H4K20ac), 'Lys-79'(H4K79ac) and 'Lys-91' (H4K91ac). Also displays alpha (N-terminal) acetyltransferase activity towards a range of N-terminal sequences including those starting with Met-Lys, Met-Val, Met-Ala and Met-Met. Required for normal chromosomal segregation during anaphase.
GO Classification
Biological Process
cell proliferation
N-terminal peptidyl-methionine acetylation
chromosome segregation
nucleosome assembly
Cellular Component
Golgi membrane
Molecular Function
peptide alpha-N-acetyltransferase activity
H4 histone acetyltransferase activity
Cellular Location Not Available
Pathways
Gene Properties
Chromosome Location 16
Locus 16p13.3
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 27451.075
Theoretical pI 7.604
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>gi|134254440|ref|NP_001077069.1| N-alpha-acetyltransferase 60 [Homo sapiens]
MTEVVPSSALSEVSLRLLCHDDIDTVKHLCGDWFPIEYPDSWYRDITSNKKFFSLAATYR
GAIVGMIVAE
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9H7X0
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:25875
References
General References Not Available