| Identification |
|---|
| HMDB Protein ID
| CDBP05397 |
| Secondary Accession Numbers
| Not Available |
| Name
| N-alpha-acetyltransferase 20 |
| Description
| Not Available |
| Synonyms
|
- Methionine N-acetyltransferase
- N-acetyltransferase 5
- N-terminal acetyltransferase B complex catalytic subunit NAA20
- N-terminal acetyltransferase B complex catalytic subunit NAT5
- NatB catalytic subunit
- NatB complex subunit NAT5
|
| Gene Name
| NAA20 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Catalytic subunit of the NatB complex which catalyzes acetylation of the N-terminal methionine residues of peptides beginning with Met-Asp, Met-Glu, Met-Asn and Met-Gln. Proteins with cell cycle functions are overrepresented in the pool of NatB substrates. Required for maintaining the structure and function of actomyosin fibers and for proper cellular migration.
|
| GO Classification
|
| Cellular Component |
| nucleus |
| intracellular |
| cytoplasm |
| Molecular Function |
| peptide alpha-N-acetyltransferase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 20 |
| Locus
| 20p11.23 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 20367.985 |
| Theoretical pI
| 5.031 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|7705823|ref|NP_057184.1| N-alpha-acetyltransferase 20 isoform a [Homo sapiens]
MTTLRAFTCDDLFRFNNINLDPLTETYGIPFYLQYLAHWPEYFIVAEAPGGELMGYIMGK
AEGSVAREEW
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| P61599 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:15908 |
| References |
|---|
| General References
| Not Available |