Showing Protein Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 (CDBP05394)

IdentificationBiological propertiesGene propertiesProtein propertiesExternal linksReferencesXMLShow 2 compounds
Identification
HMDB Protein ID CDBP05394
Secondary Accession Numbers Not Available
Name Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1
Description Not Available
Synonyms
  1. Cap1 2'O-ribose methyltransferase 1
  2. FtsJ methyltransferase domain-containing protein 2
  3. Interferon-stimulated gene 95 kDa protein
  4. MTr1
  5. hMTr1
  6. ISG95
Gene Name FTSJD2
Protein Type Enzyme
Biological Properties
General Function Not Available
Specific Function S-adenosyl-L-methionine-dependent methyltransferase that mediates mRNA cap1 2'-O-ribose methylation to the 5'-cap structure of mRNAs. Methylates the ribose of the first nucleotide of a m(7)GpppG-capped mRNA to produce m(7)GpppNmp (cap1). Cap1 modification is linked to higher levels of translation. May be involved in the interferon response pathway.
GO Classification
Biological Process
7-methylguanosine mRNA capping
Cellular Component
cytoplasm
nucleus
Molecular Function
nucleic acid binding
mRNA (nucleoside-2'-O-)-methyltransferase activity
Cellular Location Not Available
Pathways
Gene Properties
Chromosome Location 6
Locus 6p21.2
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 95319.96
Theoretical pI 7.055
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence 
>gi|24307983|ref|NP_055865.1| cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 [Homo sapiens]
MKRRTDPECTAPIKKQKKRVAELALSLSSTSDDEPPSSVSHGAKASTTSLSGSDSETEGK
QHSSDSFDDA
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q8N1G2
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:21077
References
General References Not Available