| Identification |
|---|
| HMDB Protein ID
| CDBP05393 |
| Secondary Accession Numbers
| Not Available |
| Name
| Methylthioribulose-1-phosphate dehydratase |
| Description
| Not Available |
| Synonyms
|
- MTRu-1-P dehydratase
- APAF1-interacting protein
- hAPIP
|
| Gene Name
| APIP |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Catalyzes the dehydration of methylthioribulose-1-phosphate (MTRu-1-P) into 2,3-diketo-5-methylthiopentyl-1-phosphate (DK-MTP-1-P). Functions in the methionine salvage pathway, which plays a key role in cancer, apoptosis, microbial proliferation and inflammation. May inhibit the CASP1-related inflammatory response (pyroptosis), the CASP9-dependent apoptotic pathway and the cytochrome c-dependent and APAF1-mediated cell death.
|
| GO Classification
|
| Biological Process |
| apoptotic process |
| negative regulation of apoptotic process |
| L-methionine salvage from methylthioadenosine |
| polyamine metabolic process |
| Cellular Component |
| cytosol |
| Molecular Function |
| metal ion binding |
| methylthioribulose 1-phosphate dehydratase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
| Name | SMPDB/Pathwhiz | KEGG | | L-methionine biosynthesis via salvage pathway | Not Available | Not Available | | Cysteine and methionine metabolism | Not Available |  |
|
| Gene Properties |
|---|
| Chromosome Location
| 11 |
| Locus
| 11p13 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 27125.065 |
| Theoretical pI
| 7.123 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|166235186|ref|NP_057041.2| methylthioribulose-1-phosphate dehydratase [Homo sapiens]
MSGCDAREGDCCSRRCGAQDKEHPRYLIPELCKQFYHLGWVTGTGGGISLKHGDEIYIAP
SGVQKERIQP
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q96GX9 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:17581 |
| References |
|---|
| General References
| Not Available |