| Identification |
|---|
| HMDB Protein ID
| CDBP05392 |
| Secondary Accession Numbers
| Not Available |
| Name
| Methylthioribose-1-phosphate isomerase |
| Description
| Not Available |
| Synonyms
|
- M1Pi
- MTR-1-P isomerase
- Mediator of RhoA-dependent invasion
- S-methyl-5-thioribose-1-phosphate isomerase
- Translation initiation factor eIF-2B subunit alpha/beta/delta-like protein
|
| Gene Name
| MRI1 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Catalyzes the interconversion of methylthioribose-1-phosphate (MTR-1-P) into methylthioribulose-1-phosphate (MTRu-1-P). Independently from catalytic activity, promotes cell invasion in response to constitutive RhoA activation by promoting FAK tyrosine phosphorylation and stress fiber turnover.
|
| GO Classification
|
| Biological Process |
| L-methionine salvage from methylthioadenosine |
| polyamine metabolic process |
| Cellular Component |
| cytosol |
| cell projection |
| nucleus |
| Molecular Function |
| S-methyl-5-thioribose-1-phosphate isomerase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
| Name | SMPDB/Pathwhiz | KEGG | | L-methionine biosynthesis via salvage pathway | Not Available | Not Available | | Cysteine and methionine metabolism | Not Available |  |
|
| Gene Properties |
|---|
| Chromosome Location
| 19 |
| Locus
| 19p13.2 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 39149.38 |
| Theoretical pI
| 6.297 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|72534748|ref|NP_001026897.1| methylthioribose-1-phosphate isomerase isoform 1 [Homo sapiens]
MTLEAIRYSRGSLQILDQLLLPKQSRYEAVGSVHQAWEAIRAMKVRGAPAIALVGCLSLA
VELQAGAGGP
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9BV20 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:28469 |
| References |
|---|
| General References
| Not Available |