| Identification |
|---|
| HMDB Protein ID
| CDBP05387 |
| Secondary Accession Numbers
| Not Available |
| Name
| Mitochondrial pyruvate carrier 2 |
| Description
| Not Available |
| Synonyms
|
- Brain protein 44
|
| Gene Name
| MPC2 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Mediates the uptake of pyruvate into mitochondria.
|
| GO Classification
|
| Biological Process |
| transport |
| Cellular Component |
| mitochondrion |
| integral to membrane |
| mitochondrial inner membrane |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 1 |
| Locus
| 1q24 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 14278.74 |
| Theoretical pI
| 10.435 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|219521872|ref|NP_001137146.1| mitochondrial pyruvate carrier 2 [Homo sapiens]
MSAAGARGLRATYHRLLDKVELMLPEKLRPLYNHPAGPRTVFFWAPIMKWGLVCAGLADM
ARPAEKLSTA
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| O95563 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:24515 |
| References |
|---|
| General References
| Not Available |