| Identification |
| HMDB Protein ID
| CDBP05381 |
| Secondary Accession Numbers
| Not Available |
| Name
| Bifunctional lysine-specific demethylase and histidyl-hydroxylase MINA |
| Description
| Not Available |
| Synonyms
|
- 60S ribosomal protein L27a histidine hydroxylase
- Histone lysine demethylase MINA
- MYC-induced nuclear antigen
- Mineral dust-induced gene protein
- Nucleolar protein 52
- Ribosomal oxygenase MINA
- ROX
|
| Gene Name
| MINA |
| Protein Type
| Enzyme |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Oxygenase that can act as both a histone lysine demethylase and a ribosomal histidine hydroxylase. Is involved in the demethylation of trimethylated 'Lys-9' on histone H3 (H3K9me3), leading to an increase in ribosomal RNA expression. Also catalyzes the hydroxylation of 60S ribosomal protein L27a on 'His-39'. May play an important role in cell growth and survival. May be involved in ribosome biogenesis, most likely during the assembly process of pre-ribosomal particles.
|
| GO Classification
|
| Biological Process |
| ribosome biogenesis |
| Cellular Component |
| cytoplasm |
| nucleolus |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 3 |
| Locus
| 3q11.2 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 52799.83 |
| Theoretical pI
| 6.695 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|110227619|ref|NP_001035998.1| bifunctional lysine-specific demethylase and histidyl-hydroxylase MINA isoform a [Homo sapiens]
MPKKAKPTGSGKEEGPAPCKQMKLEAAGGPSALNFDSPSSLFESLISPIKTETFFKEFWE
QKPLLIQRDD
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q8IUF8 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:19441 |
| References |
| General References
| Not Available |