| Identification |
|---|
| HMDB Protein ID
| CDBP05380 |
| Secondary Accession Numbers
| Not Available |
| Name
| Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase B |
| Description
| Not Available |
| Synonyms
|
- Alpha-mannoside beta-1,6-N-acetylglucosaminyltransferase B
- GlcNAc-T Vb
- Mannoside acetylglucosaminyltransferase 5B
- N-acetylglucosaminyl-transferase Vb
- N-acetylglucosaminyltransferase IX
- GNT-Vb
- hGnTVb
- GNT-IX
|
| Gene Name
| MGAT5B |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Glycosyltransferase that acts on alpha-linked mannose of N-glycans and O-mannosyl glycans. Catalyzes the transfer of N-acetylglucosamine (GlcNAc) to the beta 1-6 linkage of the mannose residue of GlcNAcbeta1,2-Manalpha on both the alpha1,3- and alpha1,6-linked mannose arms in the core structure of N-glycan. Also acts on the GlcNAcbeta1,2-Manalpha1-Ser/Thr moiety, forming a 2,6-branched structure in brain O-mannosyl glycan. Plays an active role in modulating integrin and laminin-dependent adhesion and migration of neuronal cells via its activity in the O-mannosyl glycan pathway.
|
| GO Classification
|
| Biological Process |
| protein N-linked glycosylation |
| Cellular Component |
| integral to membrane |
| Golgi membrane |
| Molecular Function |
| metal ion binding |
| alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
| Name | SMPDB/Pathwhiz | KEGG | | protein glycosylation | Not Available | Not Available | | N-Glycan biosynthesis | Not Available |  | | Other types of O-glycan biosynthesis | Not Available |  |
|
| Gene Properties |
|---|
| Chromosome Location
| 17 |
| Locus
| 17q25.2 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 89534.545 |
| Theoretical pI
| 8.359 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|312596905|ref|NP_001186101.1| alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase B isoform 3 [Homo sapiens]
MITVNPDGKIMVRRCLVTLRPFRLFVLGIGFFTLCFLMTSLGGQFSARRLGDSPFTIRTE
VMGGPESRGV
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q3V5L5 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:24140 |
| References |
|---|
| General References
| Not Available |