Showing Protein Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase (CDBP05378)

IdentificationBiological propertiesGene propertiesProtein propertiesExternal linksReferencesXMLShow 1 compounds
Identification
HMDB Protein ID CDBP05378
Secondary Accession Numbers Not Available
Name Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
Description Not Available
Synonyms
  1. N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase I
  2. GNT-I
  3. GlcNAc-T I
Gene Name MGAT1
Protein Type Enzyme
Biological Properties
General Function Not Available
Specific Function Initiates complex N-linked carbohydrate formation. Essential for the conversion of high-mannose to hybrid and complex N-glycans.
GO Classification
Biological Process
UDP-N-acetylglucosamine catabolic process
in utero embryonic development
post-translational protein modification
protein N-linked glycosylation via asparagine
Cellular Component
integral to membrane
Golgi membrane
Molecular Function
metal ion binding
acetylglucosaminyltransferase activity
alpha-1,3-mannosylglycoprotein 2-beta-N-acetylglucosaminyltransferase activity
Cellular Location Not Available
Pathways
Gene Properties
Chromosome Location 5
Locus 5q35
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 50877.88
Theoretical pI 9.161
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence 
>gi|167857780|ref|NP_001108089.1| alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase [Homo sapiens]
MLKKQSAGLVLWGAILFVAWNALLLLFFWTRPAPGRPPSVSALDGDPASLTREVIRLAQD
AEVELERQRG
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P26572
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:7044
References
General References Not Available