| Identification |
| HMDB Protein ID
| CDBP05369 |
| Secondary Accession Numbers
| Not Available |
| Name
| DNA replication licensing factor MCM3 |
| Description
| Not Available |
| Synonyms
|
- DNA polymerase alpha holoenzyme-associated protein P1
- P1-MCM3
- RLF subunit beta
- p102
|
| Gene Name
| MCM3 |
| Protein Type
| Enzyme |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Acts as component of the MCM2-7 complex (MCM complex) which is the putative replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. The active ATPase sites in the MCM2-7 ring are formed through the interaction surfaces of two neighboring subunits such that a critical structure of a conserved arginine finger motif is provided in trans relative to the ATP-binding site of the Walker A box of the adjacent subunit. The six ATPase active sites, however, are likely to contribute differentially to the complex helicase activity. Required for DNA replication and cell proliferation.
|
| GO Classification
|
| Biological Process |
| DNA strand elongation involved in DNA replication |
| DNA replication initiation |
| M/G1 transition of mitotic cell cycle |
| S phase of mitotic cell cycle |
| G1/S transition of mitotic cell cycle |
| cell cycle checkpoint |
| Cellular Component |
| centrosome |
| perinuclear region of cytoplasm |
| nucleoplasm |
| alpha DNA polymerase:primase complex |
| MCM complex |
| Molecular Function |
| ATP binding |
| DNA binding |
| helicase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
| Name | SMPDB/Pathwhiz | KEGG | | DNA replication | Not Available |  | | Cell cycle | Not Available |  |
|
| Gene Properties |
| Chromosome Location
| 6 |
| Locus
| 6p12 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 91929.485 |
| Theoretical pI
| 6.332 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|394582099|ref|NP_001257401.1| DNA replication licensing factor MCM3 isoform 2 [Homo sapiens]
MLICSQGPRLFLEVTFGGGKSSEVFAPGWSHPGNLHATLVEVVLWQRAWRVPWCWTMWSC
GRLREITWTS
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| P25205 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:6945 |
| References |
| General References
| Not Available |