Identification
HMDB Protein ID CDBP05369
Secondary Accession Numbers Not Available
Name DNA replication licensing factor MCM3
Description Not Available
Synonyms
  1. DNA polymerase alpha holoenzyme-associated protein P1
  2. P1-MCM3
  3. RLF subunit beta
  4. p102
Gene Name MCM3
Protein Type Enzyme
Biological Properties
General Function Not Available
Specific Function Acts as component of the MCM2-7 complex (MCM complex) which is the putative replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. The active ATPase sites in the MCM2-7 ring are formed through the interaction surfaces of two neighboring subunits such that a critical structure of a conserved arginine finger motif is provided in trans relative to the ATP-binding site of the Walker A box of the adjacent subunit. The six ATPase active sites, however, are likely to contribute differentially to the complex helicase activity. Required for DNA replication and cell proliferation.
GO Classification
Biological Process
DNA strand elongation involved in DNA replication
DNA replication initiation
M/G1 transition of mitotic cell cycle
S phase of mitotic cell cycle
G1/S transition of mitotic cell cycle
cell cycle checkpoint
Cellular Component
centrosome
perinuclear region of cytoplasm
nucleoplasm
alpha DNA polymerase:primase complex
MCM complex
Molecular Function
ATP binding
DNA binding
helicase activity
Cellular Location Not Available
Pathways
Gene Properties
Chromosome Location 6
Locus 6p12
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 91929.485
Theoretical pI 6.332
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>gi|394582099|ref|NP_001257401.1| DNA replication licensing factor MCM3 isoform 2 [Homo sapiens]
MLICSQGPRLFLEVTFGGGKSSEVFAPGWSHPGNLHATLVEVVLWQRAWRVPWCWTMWSC
GRLREITWTS
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P25205
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:6945
References
General References Not Available