Identification
HMDB Protein ID CDBP05366
Secondary Accession Numbers Not Available
Name Lysophospholipid acyltransferase 2
Description Not Available
Synonyms
  1. LPLAT 2
  2. 1-acylglycerophosphate O-acyltransferase
  3. 1-acylglycerophosphoethanolamine O-acyltransferase
  4. Lysophosphatidic acid acyltransferase
  5. Lysophosphatidylethanolamine acyltransferase
  6. Membrane-bound O-acyltransferase domain-containing protein 2
  7. LPAAT
  8. Lyso-PA acyltransferase
  9. LPEAT
  10. Lyso-PE acyltransferase
  11. O-acyltransferase domain-containing protein 2
Gene Name MBOAT2
Protein Type Enzyme
Biological Properties
General Function Not Available
Specific Function Acyltransferase which mediates the conversion of lysophosphatidylethanolamine (1-acyl-sn-glycero-3-phosphoethanolamine or LPE) into phosphatidylethanolamine (1,2-diacyl-sn-glycero-3-phosphoethanolamine or PE) (LPEAT activity). Catalyzes also the acylation of lysophosphatidic acid (LPA) into phosphatidic acid (PA) (LPAAT activity). Has also a very weak lysophosphatidylcholine acyltransferase (LPCAT activity). Prefers oleoyl-CoA as the acyl donor. Lysophospholipid acyltransferases (LPLATs) catalyze the reacylation step of the phospholipid remodeling pathway also known as the Lands cycle.
GO Classification
Biological Process
phosphatidylcholine acyl-chain remodeling
phosphatidylethanolamine acyl-chain remodeling
glycerophospholipid biosynthetic process
Cellular Component
endoplasmic reticulum membrane
integral to membrane
Molecular Function
1-acylglycerol-3-phosphate O-acyltransferase activity
Cellular Location Not Available
Pathways
Gene Properties
Chromosome Location 2
Locus 2p25.1
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 59526.225
Theoretical pI 8.036
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>gi|40548387|ref|NP_620154.2| lysophospholipid acyltransferase 2 [Homo sapiens]
MATTSTTGSTLLQPLSNAVQLPIDQVNFVVCQLFALLAAIWFRTYLHSSKTSSFIRHVVA
TLLGLYLALF
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q6ZWT7
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:25193
References
General References Not Available