| Identification |
|---|
| HMDB Protein ID
| CDBP05362 |
| Secondary Accession Numbers
| Not Available |
| Name
| Lysosomal alpha-mannosidase |
| Description
| Not Available |
| Synonyms
|
- Laman
- Lysosomal acid alpha-mannosidase
- Mannosidase alpha class 2B member 1
- Mannosidase alpha-B
|
| Gene Name
| MAN2B1 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Necessary for the catabolism of N-linked carbohydrates released during glycoprotein turnover. Cleaves all known types of alpha-mannosidic linkages.
|
| GO Classification
|
| Biological Process |
| learning or memory |
| protein deglycosylation |
| mannose metabolic process |
| Cellular Component |
| lysosome |
| Molecular Function |
| metal ion binding |
| mannose binding |
| zinc ion binding |
| alpha-mannosidase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
| Name | SMPDB/Pathwhiz | KEGG | | Other glycan degradation | Not Available |  | | Lysosome | Not Available |  |
|
| Gene Properties |
|---|
| Chromosome Location
| 19 |
| Locus
| 19cen-q13.1 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 113743.26 |
| Theoretical pI
| 7.282 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|51873064|ref|NP_000519.2| lysosomal alpha-mannosidase isoform 1 precursor [Homo sapiens]
MGAYARASGVCARGCLDSAGPWTMSRALRPPLPPLCFFLLLLAAAGARAGGYETCPTVQP
NMLNVHLLPH
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| O00754 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:6826 |
| References |
|---|
| General References
| Not Available |