| Identification |
|---|
| HMDB Protein ID
| CDBP05361 |
| Secondary Accession Numbers
| Not Available |
| Name
| Alpha-mannosidase 2x |
| Description
| Not Available |
| Synonyms
|
- Alpha-mannosidase IIx
- Mannosidase alpha class 2A member 2
- Mannosyl-oligosaccharide 1,3-1,6-alpha-mannosidase
- Man IIx
|
| Gene Name
| MAN2A2 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Catalyzes the first committed step in the biosynthesis of complex N-glycans. It controls conversion of high mannose to complex N-glycans; the final hydrolytic step in the N-glycan maturation pathway.
|
| GO Classification
|
| Biological Process |
| post-translational protein modification |
| protein N-linked glycosylation via asparagine |
| mannose metabolic process |
| Cellular Component |
| integral to membrane |
| Golgi membrane |
| Molecular Function |
| mannosyl-oligosaccharide 1,3-1,6-alpha-mannosidase activity |
| metal ion binding |
| carbohydrate binding |
| zinc ion binding |
|
| Cellular Location
|
Not Available
|
| Pathways
|
| Name | SMPDB/Pathwhiz | KEGG | | protein glycosylation | Not Available | Not Available | | N-Glycan biosynthesis | Not Available |  |
|
| Gene Properties |
|---|
| Chromosome Location
| 15 |
| Locus
| 15q26.1 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 130537.495 |
| Theoretical pI
| 6.838 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|51477716|ref|NP_006113.2| alpha-mannosidase 2x [Homo sapiens]
MKLKKQVTVCGAAIFCVAVFSLYLMLDRVQHDPTRHQNGGNFPRSQISVLQNRIEQLEQL
LEENHEIISH
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| P49641 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:6825 |
| References |
|---|
| General References
| Not Available |