Identification |
HMDB Protein ID
| CDBP05357 |
Secondary Accession Numbers
| Not Available |
Name
| Phosphatidate phosphatase LPIN1 |
Description
| Not Available |
Synonyms
|
- Lipin-1
|
Gene Name
| LPIN1 |
Protein Type
| Enzyme |
Biological Properties |
General Function
| Not Available |
Specific Function
| Plays important roles in controlling the metabolism of fatty acids at differents levels. Acts as a magnesium-dependent phosphatidate phosphatase enzyme which catalyzes the conversion of phosphatidic acid to diacylglycerol during triglyceride, phosphatidylcholine and phosphatidylethanolamine biosynthesis in the reticulum endoplasmic membrane. Acts also as a nuclear transcriptional coactivator for PPARGC1A/PPARA to modulate lipid metabolism gene expression (By similarity). Is involved in adipocyte differentiation. May also be involved in mitochondrial fission by converting phosphatidic acid to diacylglycerol (By similarity).
|
GO Classification
|
Biological Process |
fatty acid catabolic process |
phosphatidylethanolamine biosynthetic process |
phosphatidylcholine biosynthetic process |
positive regulation of histone deacetylation |
regulation of fat cell differentiation |
ruffle organization |
triglyceride mobilization |
cellular response to insulin stimulus |
negative regulation of transcription from RNA polymerase II promoter |
positive regulation of transcription from RNA polymerase II promoter |
actin cytoskeleton reorganization |
triglyceride biosynthetic process |
transcription, DNA-dependent |
mitochondrial fission |
organ regeneration |
Cellular Component |
transcription factor complex |
endoplasmic reticulum membrane |
cytosol |
nuclear membrane |
Molecular Function |
phosphatidate phosphatase activity |
transcription coactivator activity |
|
Cellular Location
|
Not Available
|
Pathways
|
Name | SMPDB/Pathwhiz | KEGG | Glycerophospholipid metabolism | Not Available |  | De Novo Triacylglycerol Biosynthesis |    | Not Available | De Novo Triacylglycerol Biosynthesis TG(10:0/10:0/10:0) |    | Not Available | De Novo Triacylglycerol Biosynthesis TG(16:0/16:0/16:0) |    | Not Available | De Novo Triacylglycerol Biosynthesis TG(16:0/16:0/18:0) |    | Not Available |
|
Gene Properties |
Chromosome Location
| 2 |
Locus
| 2p25.1 |
SNPs
| Not Available |
Gene Sequence
|
Not Available
|
Protein Properties |
Number of Residues
| Not Available |
Molecular Weight
| 99366.085 |
Theoretical pI
| 6.656 |
Pfam Domain Function
|
|
Signals
|
Not Available
|
Transmembrane Regions
|
Not Available
|
Protein Sequence
|
>gi|387528011|ref|NP_001248356.1| phosphatidate phosphatase LPIN1 isoform 2 [Homo sapiens]
MSRVQTMNYVGQLAGQVFVTVKELYKGLNPATLSGCIDIIVIRQPNGNLQCSPFHVRFGK
MGVLRSREKV
|
External Links |
GenBank ID Protein
| Not Available |
UniProtKB/Swiss-Prot ID
| Q14693 |
UniProtKB/Swiss-Prot Entry Name
| Not Available |
PDB IDs
|
Not Available |
GenBank Gene ID
| Not Available |
GeneCard ID
| Not Available |
GenAtlas ID
| Not Available |
HGNC ID
| HGNC:13345 |
References |
General References
| Not Available |