Identification
HMDB Protein ID CDBP05357
Secondary Accession Numbers Not Available
Name Phosphatidate phosphatase LPIN1
Description Not Available
Synonyms
  1. Lipin-1
Gene Name LPIN1
Protein Type Enzyme
Biological Properties
General Function Not Available
Specific Function Plays important roles in controlling the metabolism of fatty acids at differents levels. Acts as a magnesium-dependent phosphatidate phosphatase enzyme which catalyzes the conversion of phosphatidic acid to diacylglycerol during triglyceride, phosphatidylcholine and phosphatidylethanolamine biosynthesis in the reticulum endoplasmic membrane. Acts also as a nuclear transcriptional coactivator for PPARGC1A/PPARA to modulate lipid metabolism gene expression (By similarity). Is involved in adipocyte differentiation. May also be involved in mitochondrial fission by converting phosphatidic acid to diacylglycerol (By similarity).
GO Classification
Biological Process
fatty acid catabolic process
phosphatidylethanolamine biosynthetic process
phosphatidylcholine biosynthetic process
positive regulation of histone deacetylation
regulation of fat cell differentiation
ruffle organization
triglyceride mobilization
cellular response to insulin stimulus
negative regulation of transcription from RNA polymerase II promoter
positive regulation of transcription from RNA polymerase II promoter
actin cytoskeleton reorganization
triglyceride biosynthetic process
transcription, DNA-dependent
mitochondrial fission
organ regeneration
Cellular Component
transcription factor complex
endoplasmic reticulum membrane
cytosol
nuclear membrane
Molecular Function
phosphatidate phosphatase activity
transcription coactivator activity
Cellular Location Not Available
Pathways
Gene Properties
Chromosome Location 2
Locus 2p25.1
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 99366.085
Theoretical pI 6.656
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>gi|387528011|ref|NP_001248356.1| phosphatidate phosphatase LPIN1 isoform 2 [Homo sapiens]
MSRVQTMNYVGQLAGQVFVTVKELYKGLNPATLSGCIDIIVIRQPNGNLQCSPFHVRFGK
MGVLRSREKV
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q14693
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:13345
References
General References Not Available