| Identification |
|---|
| HMDB Protein ID
| CDBP05356 |
| Secondary Accession Numbers
| Not Available |
| Name
| Probable lysosomal cobalamin transporter |
| Description
| Not Available |
| Synonyms
|
- HDAg-L-interacting protein NESI
- LMBR1 domain-containing protein 1
- Nuclear export signal-interacting protein
|
| Gene Name
| LMBRD1 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Probable lysosomal cobalamin transporter. Required to export cobalamin from lysosomes allowing its conversion to cofactors. Isoform 3 may play a role in the assembly of hepatitis delta virus (HDV).
|
| GO Classification
|
| Biological Process |
| virus-host interaction |
| transport |
| Cellular Component |
| lysosomal membrane |
| integral to membrane |
| Molecular Function |
| cobalamin binding |
|
| Cellular Location
|
Not Available
|
| Pathways
|
| Name | SMPDB/Pathwhiz | KEGG | | Vitamin digestion and absorption | Not Available |  |
|
| Gene Properties |
|---|
| Chromosome Location
| 6 |
| Locus
| 6q13 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 61387.965 |
| Theoretical pI
| 7.763 |
| Pfam Domain Function
|
|
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|261878497|ref|NP_060838.3| probable lysosomal cobalamin transporter [Homo sapiens]
MATSGAASAELVIGWCIFGLLLLAILAFCWIYVRKYQSRRESEVVSTITAIFSLAIALIT
SALLPVDIFL
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9NUN5 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:23038 |
| References |
|---|
| General References
| Not Available |