| Identification |
|---|
| HMDB Protein ID
| CDBP05349 |
| Secondary Accession Numbers
| Not Available |
| Name
| DNA helicase INO80 |
| Description
| Not Available |
| Synonyms
|
- hINO80
- INO80 complex subunit A
- Putative DNA helicase INO80 complex homolog 1
|
| Gene Name
| INO80 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| DNA helicase and probable main scaffold component of the chromatin remodeling INO80 complex which is involved in transcriptional regulation, DNA replication and probably DNA repair; according to PubMed:20687897 the contribution to DNA double-strand break repair appears to be largely indirect through transcriptional regulation. Recruited by YY1 to YY1-activated genes, where it acts as an essential coactivator. Binds DNA. In vitro, has double stranded DNA-dependent ATPase activity. Involved in UV-damage excision repair, DNA replication and chromosome segregation during normal cell division cycle.
|
| GO Classification
|
| Biological Process |
| positive regulation of DNA replication involved in S phase |
| regulation of G1/S transition of mitotic cell cycle |
| spindle assembly |
| UV-damage excision repair |
| positive regulation of transcription from RNA polymerase II promoter |
| positive regulation of cell growth |
| cellular response to ionizing radiation |
| cell division |
| mitotic sister chromatid segregation |
| double-strand break repair via homologous recombination |
| chromatin remodeling |
| cellular response to UV |
| Cellular Component |
| Ino80 complex |
| microtubule |
| Molecular Function |
| alpha-tubulin binding |
| ATP binding |
| ATPase activity |
| DNA helicase activity |
| DNA binding |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 15 |
| Locus
| 15q15.1 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 176751.655 |
| Theoretical pI
| 9.501 |
| Pfam Domain Function
|
|
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|38708321|ref|NP_060023.1| DNA helicase INO80 [Homo sapiens]
MASELGARDDGGCTELAKPLYLQYLERALRLDHFLRQTSAIFNRNISSDDSEDGLDDSNP
LLPQSGDPLI
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9ULG1 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:26956 |
| References |
|---|
| General References
| Not Available |