| Identification |
| HMDB Protein ID
| CDBP05345 |
| Secondary Accession Numbers
| Not Available |
| Name
| Eukaryotic initiation factor 4A-I |
| Description
| Not Available |
| Synonyms
|
- eIF-4A-I
- eIF4A-I
- ATP-dependent RNA helicase eIF4A-1
|
| Gene Name
| EIF4A1 |
| Protein Type
| Enzyme |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| ATP-dependent RNA helicase which is a subunit of the eIF4F complex involved in cap recognition and is required for mRNA binding to ribosome. In the current model of translation initiation, eIF4A unwinds RNA secondary structures in the 5'-UTR of mRNAs which is necessary to allow efficient binding of the small ribosomal subunit, and subsequent scanning for the initiator codon.
|
| GO Classification
|
| Biological Process |
| organ regeneration |
| nuclear-transcribed mRNA poly(A) tail shortening |
| virus-host interaction |
| cytokine-mediated signaling pathway |
| translational initiation |
| Cellular Component |
| cytosol |
| eukaryotic translation initiation factor 4F complex |
| Molecular Function |
| RNA cap binding |
| translation factor activity, nucleic acid binding |
| ATP-dependent helicase activity |
| translation initiation factor activity |
| mRNA binding |
| helicase activity |
| ATP binding |
|
| Cellular Location
|
Not Available
|
| Pathways
|
| Name | SMPDB/Pathwhiz | KEGG | | RNA transport | Not Available |  |
|
| Gene Properties |
| Chromosome Location
| 17 |
| Locus
| 17p13 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 39548.13 |
| Theoretical pI
| 5.823 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|325197164|ref|NP_001191439.1| eukaryotic initiation factor 4A-I isoform 2 [Homo sapiens]
MSASQDSRSRDNGPDGMEPEGVIESNWNEIVDSFDDMNLSESLLRGIYAYGFEKPSAIQQ
RAILPCIKGY
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| P60842 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:3282 |
| References |
| General References
| Not Available |