| Identification |
| HMDB Protein ID
| CDBP05335 |
| Secondary Accession Numbers
| Not Available |
| Name
| Putative hexokinase HKDC1 |
| Description
| Not Available |
| Synonyms
|
- Hexokinase domain-containing protein 1
|
| Gene Name
| HKDC1 |
| Protein Type
| Enzyme |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Not Available |
| GO Classification
|
| Biological Process |
| glycolysis |
| cellular glucose homeostasis |
| Cellular Component |
| cytosol |
| mitochondrion |
| nucleus |
| Molecular Function |
| mannokinase activity |
| ATP binding |
| fructokinase activity |
| glucokinase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
| Name | SMPDB/Pathwhiz | KEGG | | hexose metabolism | Not Available | Not Available | | Glycolysis / Gluconeogenesis | Not Available |  | | Fructose and mannose metabolism | Not Available |  | | Amino sugar and nucleotide sugar metabolism | Not Available |  | | Butirosin and neomycin biosynthesis | Not Available |  |
|
| Gene Properties |
| Chromosome Location
| 10 |
| Locus
| 10q22.1 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 102513.88 |
| Theoretical pI
| 7.24 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|156151420|ref|NP_079406.3| putative hexokinase HKDC1 [Homo sapiens]
MFAVHLMAFYFSKLKEDQIKKVDRFLYHMRLSDDTLLDIMRRFRAEMEKGLAKDTNPTAA
VKMLPTFVRA
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q2TB90 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:23302 |
| References |
| General References
| Not Available |