| Identification |
|---|
| HMDB Protein ID
| CDBP05331 |
| Secondary Accession Numbers
| Not Available |
| Name
| Small RNA 2'-O-methyltransferase |
| Description
| Not Available |
| Synonyms
|
- HEN1 methyltransferase homolog 1
|
| Gene Name
| HENMT1 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Methyltransferase that adds a 2'-O-methyl group at the 3'-end of piRNAs, a class of 24 to 30 nucleotide RNAs that are generated by a Dicer-independent mechanism and are primarily derived from transposons and other repeated sequence elements. This probably protects the 3'-end of piRNAs from uridylation activity and subsequent degradation. Stabilization of piRNAs is essential for gametogenesis (By similarity).
|
| GO Classification
|
| Biological Process |
| piRNA metabolic process |
| gene silencing by RNA |
| Cellular Component |
| P granule |
| Molecular Function |
| O-methyltransferase activity |
| metal ion binding |
| RNA binding |
| RNA methyltransferase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 1 |
| Locus
| 1p13.3 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 44524.2 |
| Theoretical pI
| 5.289 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|156564367|ref|NP_001096062.1| small RNA 2'-O-methyltransferase [Homo sapiens]
MEENNLQCSSVVDGNFEEVPRETAIQFKPPLYRQRYQFVKNLVDQHEPKKVADLGCGDTS
LLRLLKVNPC
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q5T8I9 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:26400 |
| References |
|---|
| General References
| Not Available |