| Identification |
|---|
| HMDB Protein ID
| CDBP05329 |
| Secondary Accession Numbers
| Not Available |
| Name
| Helicase POLQ-like |
| Description
| Not Available |
| Synonyms
|
- Mus308-like helicase
- POLQ-like helicase
|
| Gene Name
| HELQ |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| DNA-dependent ATPase and 5' to 3' DNA helicase.
|
| GO Classification
|
| Cellular Component |
| nucleolus |
| Molecular Function |
| nucleic acid binding |
| ATP binding |
| ATP-dependent helicase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 4 |
| Locus
| 4q21.23 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 124160.21 |
| Theoretical pI
| 6.521 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|110556640|ref|NP_598375.2| helicase POLQ-like [Homo sapiens]
MDECGSRIRRRVSLPKRNRPSLGCIFGAPTAAELEPGDEGKEEEEMVAENRRRKTAGVLP
VEVQPLLLSD
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q8TDG4 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:18536 |
| References |
|---|
| General References
| Not Available |