| Identification |
|---|
| HMDB Protein ID
| CDBP05327 |
| Secondary Accession Numbers
| Not Available |
| Name
| Very-long-chain (3R)-3-hydroxyacyl-[acyl-carrier protein] dehydratase 4 |
| Description
| Not Available |
| Synonyms
|
- 3-hydroxyacyl-CoA dehydratase 4
- Protein tyrosine phosphatase-like protein PTPLAD2
- Protein-tyrosine phosphatase-like A domain-containing protein 2
- HACD4
|
| Gene Name
| PTPLAD2 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Responsible for the dehydration step in very long-chain fatty acid (VLCFA) synthesis.
|
| GO Classification
|
| Biological Process |
| fatty acid biosynthetic process |
| Cellular Component |
| integral to membrane |
| endoplasmic reticulum membrane |
| Molecular Function |
| lyase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 9 |
| Locus
| 9p21.3 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 27519.565 |
| Theoretical pI
| 8.579 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|148226324|ref|NP_001010915.2| very-long-chain (3R)-3-hydroxyacyl-[acyl-carrier protein] dehydratase 4 [Homo sapiens]
MGPLALPAWLQPRYRKNAYLFIYYLIQFCGHSWIFTNMTVRFFSFGKDSMVDTFYAIGLV
MRLCQSVSLL
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q5VWC8 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:20920 |
| References |
|---|
| General References
| Not Available |