| Identification |
| HMDB Protein ID
| CDBP05324 |
| Secondary Accession Numbers
| Not Available |
| Name
| Glucoside xylosyltransferase 2 |
| Description
| Not Available |
| Synonyms
|
- Glycosyltransferase 8 domain-containing protein 4
|
| Gene Name
| GXYLT2 |
| Protein Type
| Enzyme |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Glycosyltransferase which elongates the O-linked glucose attached to EGF-like repeats in the extracellular domain of Notch proteins by catalyzing the addition of xylose.
|
| GO Classification
|
| Biological Process |
| O-glycan processing |
| Cellular Component |
| integral to membrane |
| Molecular Function |
| UDP-xylosyltransferase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
| Name | SMPDB/Pathwhiz | KEGG | | Other types of O-glycan biosynthesis | Not Available |  |
|
| Gene Properties |
| Chromosome Location
| 3 |
| Locus
| 3p13 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 51055.05 |
| Theoretical pI
| 9.769 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|122937187|ref|NP_001073862.1| glucoside xylosyltransferase 2 precursor [Homo sapiens]
MKLRSKAAALLLLALAALLLALLSLRAGRAEPPALPARPASAPQRHPAPVPARWPGPGAL
PGASPGVRRR
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| A0PJZ3 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:33383 |
| References |
| General References
| Not Available |