Showing Protein Solute carrier family 2, facilitated glucose transporter member 8 (CDBP05321)

IdentificationBiological propertiesGene propertiesProtein propertiesExternal linksReferencesXMLShow 0 compounds
Identification
HMDB Protein ID CDBP05321
Secondary Accession Numbers Not Available
Name Solute carrier family 2, facilitated glucose transporter member 8
Description Not Available
Synonyms
  1. Glucose transporter type 8
  2. Glucose transporter type X1
  3. GLUT-8
Gene Name SLC2A8
Protein Type Enzyme
Biological Properties
General Function Not Available
Specific Function Insulin-regulated facilitative glucose transporter. Binds cytochalasin B in a glucose-inhibitable manner. Seems to be a dual-specific sugar transporter as it is inhibitable by fructose (By similarity).
GO Classification
Biological Process
insulin receptor signaling pathway
male meiosis I
response to hypoxia
carbohydrate metabolic process
Cellular Component
synaptic vesicle
intracellular membrane-bounded organelle
integral to plasma membrane
cytoplasmic vesicle membrane
Molecular Function
glucose binding
glucose transmembrane transporter activity
Cellular Location Not Available
Pathways
Gene Properties
Chromosome Location 9
Locus 9q33.3
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 50818.54
Theoretical pI 7.607
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence 
>gi|21361449|ref|NP_055395.2| solute carrier family 2, facilitated glucose transporter member 8 isoform 1 [Homo sapiens]
MTPEDPEETQPLLGPPGGSAPRGRRVFLAAFAAALGPLSFGFALGYSSPAIPSLQRAAPP
APRLDDAAAS
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9NY64
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:13812
References
General References Not Available