| Identification |
|---|
| HMDB Protein ID
| CDBP05319 |
| Secondary Accession Numbers
| Not Available |
| Name
| Solute carrier family 2, facilitated glucose transporter member 6 |
| Description
| Not Available |
| Synonyms
|
- Glucose transporter type 6
- Glucose transporter type 9
- GLUT-6
- GLUT-9
|
| Gene Name
| SLC2A6 |
| Protein Type
| Transporter |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Facilitative glucose transporter; binds cytochalasin B with low affinity.
|
| GO Classification
|
| Cellular Component |
| plasma membrane |
| integral to membrane |
| Molecular Function |
| glucose transmembrane transporter activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 9 |
| Locus
| 9q34 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 48039.99 |
| Theoretical pI
| 9.011 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|223029430|ref|NP_001138571.1| solute carrier family 2, facilitated glucose transporter member 6 isoform 2 [Homo sapiens]
MQEPLLGAEGPDYDTFPEKPPPSPGDRARVGTLQNKRVFLATFAAVLGNFSFGYALVYTS
PVIPALERSL
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9UGQ3 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:11011 |
| References |
|---|
| General References
| Not Available |