| Identification |
|---|
| HMDB Protein ID
| CDBP05315 |
| Secondary Accession Numbers
| Not Available |
| Name
| Solute carrier family 2, facilitated glucose transporter member 14 |
| Description
| Not Available |
| Synonyms
|
- Glucose transporter type 14
- GLUT-14
|
| Gene Name
| SLC2A14 |
| Protein Type
| Transporter |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Facilitative glucose transporter (By similarity). May have a specific function related to spermatogenesis.
|
| GO Classification
|
| Biological Process |
| multicellular organismal development |
| spermatogenesis |
| glucose transport |
| cell differentiation |
| Cellular Component |
| integral to membrane |
| Molecular Function |
| glucose transmembrane transporter activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 12 |
| Locus
| 12p13.31 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 56319.575 |
| Theoretical pI
| 7.82 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|23592238|ref|NP_703150.1| solute carrier family 2, facilitated glucose transporter member 14 [Homo sapiens]
MEFHNGGHVSGIGGFLVSLTSRMKPHTLAVTPALIFAITVATIGSFQFGYNTGVINAPET
IIKEFINKTL
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q8TDB8 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:18301 |
| References |
|---|
| General References
| Not Available |