| Identification |
|---|
| HMDB Protein ID
| CDBP05312 |
| Secondary Accession Numbers
| Not Available |
| Name
| Solute carrier family 2, facilitated glucose transporter member 10 |
| Description
| Not Available |
| Synonyms
|
- Glucose transporter type 10
- GLUT-10
|
| Gene Name
| SLC2A10 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Facilitative glucose transporter.
|
| GO Classification
|
| Biological Process |
| glucose transport |
| Cellular Component |
| plasma membrane |
| perinuclear region of cytoplasm |
| endomembrane system |
| integral to membrane |
| Molecular Function |
| sugar:hydrogen symporter activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 20 |
| Locus
| 20q13.1 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 56910.77 |
| Theoretical pI
| 8.584 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|13540547|ref|NP_110404.1| solute carrier family 2, facilitated glucose transporter member 10 [Homo sapiens]
MGHSPPVLPLCASVSLLGGLTFGYELAVISGALLPLQLDFGLSCLEQEFLVGSLLLGALL
ASLVGGFLID
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| O95528 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:13444 |
| References |
|---|
| General References
| Not Available |